PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00255g11027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 137aa    MW: 15905 Da    PI: 6.6846
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00255g11027.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.65.8e-171155650
                              HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                    SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                              k+ +  tf  R++ i  KA ELS+LCd++v+ ii s++g+l++++
  Peinf101Scf00255g11027.1 11 KTSNPKTFQVRKECIKRKAMELSTLCDIKVCTIITSPEGELQTWP 55
                              4455569*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0027157IPR002100Transcription factor, MADS-box
CDDcd001204.99E-12555No hitNo description
PROSITE profilePS5006611.031954IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-161082IPR002100Transcription factor, MADS-box
PfamPF003192.0E-121154IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MADQENQNNK KTSNPKTFQV RKECIKRKAM ELSTLCDIKV CTIITSPEGE LQTWPENLQE  60
VRAVLDLYTQ TQSTNKRAKQ SQEEEKKEEE KEGEKDIMTL VESKLEAVNN RIRYLENKNA  120
GNIISVSKNK EVERFIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016449992.12e-53PREDICTED: agamous-like MADS-box protein AGL81
TrEMBLM1CBP75e-50M1CBP7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000640832e-49(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37231639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40220.14e-12AGAMOUS-like 43